Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0045 (RC0045)

This Recombinant Rickettsia conorii Uncharacterized protein RC0045 (RC0045) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0045

UniProt

Q92JM2

Expression Region

1-108

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNCPLSLQIVNVSYIVNTNSCSWIAFNNSKYPIKTIKINIININILGKINHMVIFCDNNI VIILWKIMVVIISSIIHRTYIRRWISRRNNIRRKASHACKQPNNTTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL3 Antibody
KC-1557-01 50 μL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-1557-02 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-1557-03 1 mL

CCL3 Antibody

Sign In for Pricing
View Details
TRAPPC2 (N-term) Rabbit Polyclonal Antibody
AP54353PU-N 400 µL

TRAPPC2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PROX2 Human Gene Knockout Kit (CRISPR)
KN421365 1 Kit

PROX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF640R conjugate, 0.1mg/mL
BNC402338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details