Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain protein 44-like protein (Brp44l)

This Recombinant Mouse Brain protein 44-like protein (Brp44l) spans the amino acid sequence from region 2-109.

Product Specifications

Product Name Alternative

Brain protein 44-like protein

UniProt

P63030

Expression Region

2-109

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-C-YFP | C-terminal of YFP - DyLight® 594 Conjugated (40 µg)
AS11 1775-DL594 40 µg

Anti-C-YFP | C-terminal of YFP - DyLight® 594 Conjugated (40 µg)

Sign In for Pricing
View Details
1-Bromo-3-(4-bromophenoxy)benzene
TRC-B679992-250MG 250 mg

1-Bromo-3-(4-bromophenoxy)benzene

Sign In for Pricing
View Details
RPS20 (N-term) Rabbit Polyclonal Antibody
AP53737PU-N 400 µL

RPS20 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CKS1 (CKS1B) Rabbit Polyclonal Antibody
TA368005 100 µL

CKS1 (CKS1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEDD4 Mouse Monoclonal Antibody [Clone ID: OTI6E12]
CF812646 100 µg

NEDD4 Mouse Monoclonal Antibody [Clone ID: OTI6E12]

Sign In for Pricing
View Details
Sodium Formate-1-13C
TRC-S629003-500MG 500 mg

Sodium Formate-1-13C

Sign In for Pricing
View Details