Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain protein 44-like protein (Brp44l)

This Recombinant Mouse Brain protein 44-like protein (Brp44l) spans the amino acid sequence from region 2-109.

Product Specifications

Product Name Alternative

Brain protein 44-like protein

UniProt

P63030

Expression Region

2-109

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UROD (Uroporphyrinogen Decarboxylase, PCT) (PE)
253299-PE 100 µL

UROD (Uroporphyrinogen Decarboxylase, PCT) (PE)

Sign In for Pricing
View Details
EPZ011989 HCl (1598383-40-4 Free base)
orb1703183-01 100 mg

EPZ011989 HCl (1598383-40-4 Free base)

Sign In for Pricing
View Details
EPZ011989 HCl (1598383-40-4 Free base)
orb1703183-02 50 mg

EPZ011989 HCl (1598383-40-4 Free base)

Sign In for Pricing
View Details
Anti-Shank1 Antibody (N22/21)
RHN23802 100 μg

Anti-Shank1 Antibody (N22/21)

Sign In for Pricing
View Details
Neurod1 (NM_010894) Mouse Untagged Clone
MC208033 10 µg

Neurod1 (NM_010894) Mouse Untagged Clone

Sign In for Pricing
View Details
FABP1/L-FABP Antibody
orb1538392 50 μL

FABP1/L-FABP Antibody

Sign In for Pricing
View Details