Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain protein 44-like protein (Brp44l)

This Recombinant Mouse Brain protein 44-like protein (Brp44l) spans the amino acid sequence from region 2-109.

Product Specifications

Product Name Alternative

Brain protein 44-like protein

UniProt

P63030

Expression Region

2-109

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNQ1 Antibody
MBS9607550-01 0.1 mL

KCNQ1 Antibody

Sign In for Pricing
View Details
KCNQ1 Antibody
MBS9607550-02 0.2 mL

KCNQ1 Antibody

Sign In for Pricing
View Details
KCNQ1 Antibody
MBS9607550-03 5x 0.2 mL

KCNQ1 Antibody

Sign In for Pricing
View Details
Recombinant human SKA1 protein
ATGP2596-050 50 µg

Recombinant human SKA1 protein

Sign In for Pricing
View Details
Recombinant Phl p 3
A10Z86 1 Each

Recombinant Phl p 3

Sign In for Pricing
View Details
TEAD4 (NM_003213) Human Tagged ORF Clone Lentiviral Particle
RC219686L4V 200 µL

TEAD4 (NM_003213) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details