Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Protein virB3 (virB3)

This Recombinant Agrobacterium tumefaciens Protein virB3 (virB3) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Protein virB3

UniProt

P17793

Expression Region

1-108

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARL VVERDYNAASVVLLFLQTAGRSVDGLIWGGASVSPNPIKVPARGRGMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBLIF Antibody
KC-22809-01 50 μL

CBLIF Antibody

Sign In for Pricing
View Details
CBLIF Antibody
KC-22809-02 100 µL

CBLIF Antibody

Sign In for Pricing
View Details
CBLIF Antibody
KC-22809-03 1 mL

CBLIF Antibody

Sign In for Pricing
View Details
FGFR1 (Ab-654) Antibody
8B0481-AAT 50 µg

FGFR1 (Ab-654) Antibody

Sign In for Pricing
View Details
Rrp1 Mouse Gene Knockout Kit (CRISPR)
KN515143 1 Kit

Rrp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tiglyl Glycine
TRC-T440100-250MG 250 mg

Tiglyl Glycine

Sign In for Pricing
View Details