Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein-export membrane protein SecG (secG)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

P57460

Expression Region

1-109

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLFFLIVFIFISFSLIFFILLQPGKGLNNTVHSHTKNNIKFFNSIGTNNFITKIIKILA FFFLLISIILCNINSKRIDSDFFWEDNQNNTITKKHVLDKKKLNLDIPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAR2 sgRNA gene knockout kit - Lentiviral human FAR2 sgRNA gene knockout kit (25)
GTR15377532 1 Vial

Lentiviral human FAR2 sgRNA gene knockout kit - Lentiviral human FAR2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Diethyl Succinate for Synthesis
071925 500 mL

Diethyl Succinate for Synthesis

Sign In for Pricing
View Details
SPNS1 Protein Lysate (Rat) with C-HA Tag
45357036 100 µg

SPNS1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral human POLN shRNA (UAS) - Lentiviral human POLN shRNA (UAS, iRFP) (25)
GTR15125006 1 Vial

Lentiviral human POLN shRNA (UAS) - Lentiviral human POLN shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
VC O1 mAb3
MBS478008-01 1 mg

VC O1 mAb3

Sign In for Pricing
View Details
VC O1 mAb3
MBS478008-02 2 mg

VC O1 mAb3

Sign In for Pricing
View Details