Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)

This Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, 3c protein

UniProt

P05139

Expression Region

1-109

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNLLNKSLEENGSFLTALYIIVGFLALYLLGRALQAFVQAADACCLFWYTWVVIPGAKG TAFVYKYTYGRKLNNPELEAVIVNEFPKNGWNNKNPANFQDAQRDKLYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Samd3 siRNA Oligos set (Rat)
42996176 3x 5 nmol

Samd3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
dCTP Solution (100mM)
19809-1 0.5 ml

dCTP Solution (100mM)

Sign In for Pricing
View Details
Human Cluster Of Differentiation 83 (CD83) ELISA Kit
RD-CD83-Hu-48Tests 48 Tests

Human Cluster Of Differentiation 83 (CD83) ELISA Kit

Sign In for Pricing
View Details
Gtf2a2 (NM_053345) Rat Untagged Clone
RN209035 10 µg

Gtf2a2 (NM_053345) Rat Untagged Clone

Sign In for Pricing
View Details
Llgl1 3'UTR Lenti-reporter-Luc Vector
26890086 1.0 µg

Llgl1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Omi/HtrA2
MO15078 100 µg

Omi/HtrA2

Sign In for Pricing
View Details