Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)

This Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, 3c protein

UniProt

P05139

Expression Region

1-109

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNLLNKSLEENGSFLTALYIIVGFLALYLLGRALQAFVQAADACCLFWYTWVVIPGAKG TAFVYKYTYGRKLNNPELEAVIVNEFPKNGWNNKNPANFQDAQRDKLYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine High Affinity Copper Uptake Protein 1 (SLC31A1) ELISA Kit-Sandwich
EK12F404-01 48 Test

Porcine High Affinity Copper Uptake Protein 1 (SLC31A1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine High Affinity Copper Uptake Protein 1 (SLC31A1) ELISA Kit-Sandwich
EK12F404-02 96 Tests

Porcine High Affinity Copper Uptake Protein 1 (SLC31A1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Nitrate Reagent Kit, 0-50 mg/l, 0-60 mg/l (200 tests)
HI38054 1 Each

Nitrate Reagent Kit, 0-50 mg/l, 0-60 mg/l (200 tests)

Sign In for Pricing
View Details
Dis3l2 (NM_001172157) Mouse Tagged ORF Clone Lentiviral Particle
MR216397L3V 200 µL

Dis3l2 (NM_001172157) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF488A conjugate, 0.1mg/mL
BNC880755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRGPRD Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV676956 1.0 µg DNA

MRGPRD Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details