Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB)

This Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A2BZ16

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKIFFFKILLFAYLASFLRFFLNNNLLVGVIGSFVYGFVISRRVSKLKKEILLTGFCSC FTSFSGFVLFLYEISIQGYFLKLFFYLNIIIVLNLIIMYAGFLLGRKVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS9 Protein Vector (Human) (pPB-His-GST)
PV326375 500 ng

BBS9 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
HPT mAb4
orb2280502 1 mg

HPT mAb4

Sign In for Pricing
View Details
Β-Amyloid (30-16)
E-PP-0449-01 1 mg

Β-Amyloid (30-16)

Sign In for Pricing
View Details
Β-Amyloid (30-16)
E-PP-0449-02 10 mg

Β-Amyloid (30-16)

Sign In for Pricing
View Details
Β-Amyloid (30-16)
E-PP-0449-03 5 mg

Β-Amyloid (30-16)

Sign In for Pricing
View Details
Mouse Monoclonal HLA ABC Antibody (Bra-23/9) [Alexa Fluor 700]
NBP3-20835AF700 0.1 mL

Mouse Monoclonal HLA ABC Antibody (Bra-23/9) [Alexa Fluor 700]

Sign In for Pricing
View Details