Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB)

This Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A2BZ16

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKIFFFKILLFAYLASFLRFFLNNNLLVGVIGSFVYGFVISRRVSKLKKEILLTGFCSC FTSFSGFVLFLYEISIQGYFLKLFFYLNIIIVLNLIIMYAGFLLGRKVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Relaxin-2
100-113-L250 250 µg

Relaxin-2

Sign In for Pricing
View Details
Anti-Renin Rabbit Monoclonal Antibody
MBS1757309-01 0.03 mL

Anti-Renin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Renin Rabbit Monoclonal Antibody
MBS1757309-02 0.1 mL

Anti-Renin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Renin Rabbit Monoclonal Antibody
MBS1757309-03 5x 0.1 mL

Anti-Renin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
METAP1 Protein, Human, Recombinant (His Tag)
E45H52433I2-50 50 µg

METAP1 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Mouse CAPN9 shRNA Plasmid
abx977985-01 150 µg

Mouse CAPN9 shRNA Plasmid

Sign In for Pricing
View Details