Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB)

This Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A2BZ16

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKIFFFKILLFAYLASFLRFFLNNNLLVGVIGSFVYGFVISRRVSKLKKEILLTGFCSC FTSFSGFVLFLYEISIQGYFLKLFFYLNIIIVLNLIIMYAGFLLGRKVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor (NR3C3, PGR) (PE)
MBS6122434-01 0.1 mL

Progesterone Receptor (NR3C3, PGR) (PE)

Sign In for Pricing
View Details
Progesterone Receptor (NR3C3, PGR) (PE)
MBS6122434-02 5x 0.1 mL

Progesterone Receptor (NR3C3, PGR) (PE)

Sign In for Pricing
View Details
Lentiviral human OR8D4 shRNA (UAS) - Lentiviral human OR8D4 shRNA (UAS, GFP) plasmid
GTR15337273 1 Vial

Lentiviral human OR8D4 shRNA (UAS) - Lentiviral human OR8D4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
HOR10J1 full length protein-synthetic nanodisc
orb2707723-01 10 µg

HOR10J1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HOR10J1 full length protein-synthetic nanodisc
orb2707723-02 50 µg

HOR10J1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Galectin 4 (Lgals4) Antibody (HRP)
abx319727-01 20 µg

Galectin 4 (Lgals4) Antibody (HRP)

Sign In for Pricing
View Details