Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB)

This Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A3PFC1

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKINNFIYIFLAAYLATFFRLTLNNNFFISIIGSFLVGFFVSKRLSYSNEKILFSGFFSC FTSFSGFIYFLYKILNQGDWIKFIIFFNLIIILNLLTMIFGFWISRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FN3K-RP Antibody (Biotin Conjugate)
33415-05121 150 µg

Human FN3K-RP Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Secretagogin Rabbit pAb
E45R19512N-50 50 µL

Secretagogin Rabbit pAb

Sign In for Pricing
View Details
Tris-Glycine 12% 10 Wells
TG10012Gel 10 PCs/Box

Tris-Glycine 12% 10 Wells

Sign In for Pricing
View Details
Fish Gap Junction Gamma-3 Protein (GJC3) ELISA Kit
MBS9945297 Inquire

Fish Gap Junction Gamma-3 Protein (GJC3) ELISA Kit

Sign In for Pricing
View Details
ARHGAP25 Antibody
27-164 100 µL

ARHGAP25 Antibody

Sign In for Pricing
View Details
ARMC1 ORF Vector (Human) (pORF)
ORF000626 1.0 µg DNA

ARMC1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details