Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB)

This Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A3PFC1

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKINNFIYIFLAAYLATFFRLTLNNNFFISIIGSFLVGFFVSKRLSYSNEKILFSGFFSC FTSFSGFIYFLYKILNQGDWIKFIIFFNLIIILNLLTMIFGFWISRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Speedy protein E15 (SPD15)
orb3004202-01 20 µg

Recombinant Human Speedy protein E15 (SPD15)

Sign In for Pricing
View Details
Recombinant Human Speedy protein E15 (SPD15)
orb3004202-02 100 µg

Recombinant Human Speedy protein E15 (SPD15)

Sign In for Pricing
View Details
Recombinant Human Speedy protein E15 (SPD15)
orb3004202-03 1 mg

Recombinant Human Speedy protein E15 (SPD15)

Sign In for Pricing
View Details
LRPPRC (NM_133259) Human Tagged ORF Clone Lentiviral Particle
RC216747L1V 200 µL

LRPPRC (NM_133259) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FYTTD1 Protein Lysate (Mouse) with C-HA Tag
21105034 100 µg

FYTTD1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Spi-C Transcription Factor (SPIC) Antibody (Biotin)
abx308732-01 20 µg

Spi-C Transcription Factor (SPIC) Antibody (Biotin)

Sign In for Pricing
View Details