Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB)

This Recombinant Prochlorococcus marinus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A3PFC1

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKINNFIYIFLAAYLATFFRLTLNNNFFISIIGSFLVGFFVSKRLSYSNEKILFSGFFSC FTSFSGFIYFLYKILNQGDWIKFIIFFNLIIILNLLTMIFGFWISRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tasisulam
C12608-10mg 10 mg

Tasisulam

Sign In for Pricing
View Details
Abcb7 Double Nickase Plasmid (m2)
sc-418932-NIC-2 20 µg

Abcb7 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
N-Nitroso Afatinib
CS-O-38947 1 Each

N-Nitroso Afatinib

Sign In for Pricing
View Details
RWDD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
42900154 3x 1.0 µg DNA

RWDD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Polyclonal HSPB2 antibody - middle region
APR16767G 0.05mg

Polyclonal HSPB2 antibody - middle region

Sign In for Pricing
View Details
Frizzled 10 (FZD10) (NM_007197) Human 3' UTR Clone
SC212131 10 µg

Frizzled 10 (FZD10) (NM_007197) Human 3' UTR Clone

Sign In for Pricing
View Details