Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 233 (TMEM233)

This Recombinant Human Transmembrane protein 233 (TMEM233) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Transmembrane protein 233, Interferon-induced transmembrane domain-containing protein D2

UniProt

B4DJY2

Expression Region

1-109

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFS IMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-(Dibutylamino)-1,3,5-triazine-2,4-dithiol
TRC-D462763-500MG 500 mg

6-(Dibutylamino)-1,3,5-triazine-2,4-dithiol

Sign In for Pricing
View Details
1-(3-Chloropropyl)-4-(2,5-dichlorophenyl)piperazine Hydrochloride
TRC-C734030-1G 1 g

1-(3-Chloropropyl)-4-(2,5-dichlorophenyl)piperazine Hydrochloride

Sign In for Pricing
View Details
p53 (TP53) Goat Polyclonal Antibody
AB0065-200 600 µg

p53 (TP53) Goat Polyclonal Antibody

Sign In for Pricing
View Details
ADCK1 Antibody
8C11274-AAT 50 µg

ADCK1 Antibody

Sign In for Pricing
View Details
N-Nitroso Spirapril
TRC-S682530-5MG 5 mg

N-Nitroso Spirapril

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1,  30nm
GM-202-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1, 30nm

Sign In for Pricing
View Details