Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 1 (crcB1)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q318B0

Expression Region

1-109

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIKIYIYILLACYIASFLRLFINNNFIVSIIGSLLFGFFIDKRLSYSIEKIILSGFFSC FTSFSGFIYFLYKVFNQGDLMKFIIFCNLIIIINLLVMYFGFWISRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp772 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4203705 3x 1.0 µg

Zfp772 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human IPPK Knockout HEK293T cell line
GTR15418023 1 Vial

Human IPPK Knockout HEK293T cell line

Sign In for Pricing
View Details
MEK4 Rabbit Polyclonal Antibody (APC)
orb994829 100 µL

MEK4 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
FKBP2 Rabbit pAb
A21404-01 20 µL

FKBP2 Rabbit pAb

Sign In for Pricing
View Details
FKBP2 Rabbit pAb
A21404-02 100 μL

FKBP2 Rabbit pAb

Sign In for Pricing
View Details
FKBP2 Rabbit pAb
A21404-03 500 μL

FKBP2 Rabbit pAb

Sign In for Pricing
View Details