Recombinant Zea mays V-type proton ATPase 16 kDa proteolipid subunit
This Recombinant Zea mays V-type proton ATPase 16 kDa proteolipid subunit spans the amino acid sequence from region 1-109.
Product Specifications
Product Name Alternative
V-type proton ATPase 16 kDa proteolipid subunit, V-ATPase 16 kDa proteolipid subunit, Vacuolar proton pump 16 kDa proteolipid subunit
UniProt
Q41773
Expression Region
1-109
Origin
Zea mays (Maize)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
VPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIV GDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040146-100 1x 100 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402098-100 1x 100 µL
Catenin, beta (CTNNB1) (CTNNB1/2098), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details