Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein reprimo (Rprm)

This Recombinant Rat Protein reprimo (Rprm) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q5BJN9

Expression Region

1-109

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSVLGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TAC4 siRNA
abx905432-01 15 nmol

Human TAC4 siRNA

Sign In for Pricing
View Details
Human TAC4 siRNA
abx905432-02 30 nmol

Human TAC4 siRNA

Sign In for Pricing
View Details
Tonsil Lysate
1315 0.1 mg

Tonsil Lysate

Sign In for Pricing
View Details
SLC29A2 antibody - N-terminal region
MBS3207045-01 0.1 mL

SLC29A2 antibody - N-terminal region

Sign In for Pricing
View Details
SLC29A2 antibody - N-terminal region
MBS3207045-02 5x 0.1 mL

SLC29A2 antibody - N-terminal region

Sign In for Pricing
View Details
ApoA1 Antibody [L13J2]
C21446-100uL*2 2x 100μL

ApoA1 Antibody [L13J2]

Sign In for Pricing
View Details