Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1 (crcB1)

This Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q7UZM7

Expression Region

1-109

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKKYLLTFLLTAYCATFLRFYFKNNFVISIIGSFLYGFFISRKISKSKKEILFSGFFAC FTSFSGFVHFLYQFIIQGYYLKLFIYLNVIVILNLIIMYIGFQLSRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1x (H1FX) Rabbit Polyclonal Antibody
TA368497 100 µL

Histone H1x (H1FX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phosphoric Acid Silver Salt
TRC-P359210-50G 50 g

Phosphoric Acid Silver Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800713 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit
E-CL-H0220-01 24 Tests

Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit

Sign In for Pricing
View Details
Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit
E-CL-H0220-02 48 Tests

Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit

Sign In for Pricing
View Details
Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit
E-CL-H0220-03 96 Tests

Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit

Sign In for Pricing
View Details