Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1 (crcB1)

This Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q7UZM7

Expression Region

1-109

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKKYLLTFLLTAYCATFLRFYFKNNFVISIIGSFLYGFFISRKISKSKKEILFSGFFAC FTSFSGFVHFLYQFIIQGYYLKLFIYLNVIVILNLIIMYIGFQLSRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromuconazole
TRC-B695380-25MG 25 mg

Bromuconazole

Sign In for Pricing
View Details
CHN 1 (CHN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]
TA505073BM 100 µL

CHN 1 (CHN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]

Sign In for Pricing
View Details
MID1 (NM_001098624) Human Over-expression Lysate
LY420647 100 µg

MID1 (NM_001098624) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Mouse Dkk3 (Dickkopf-related protein 3) ELISA Kit
E-UNEL-M0187-01 5x 96 Tests

Uncoated Mouse Dkk3 (Dickkopf-related protein 3) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse Dkk3 (Dickkopf-related protein 3) ELISA Kit
E-UNEL-M0187-02 15x 96 Tests

Uncoated Mouse Dkk3 (Dickkopf-related protein 3) ELISA Kit

Sign In for Pricing
View Details
CD3E Mouse Monoclonal Antibody [Clone ID: PPT3]
AM08104FC-N 500 µg

CD3E Mouse Monoclonal Antibody [Clone ID: PPT3]

Sign In for Pricing
View Details