Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1 (crcB1)

This Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q7UZM7

Expression Region

1-109

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKKYLLTFLLTAYCATFLRFYFKNNFVISIIGSFLYGFFISRKISKSKKEILFSGFFAC FTSFSGFVHFLYQFIIQGYYLKLFIYLNVIVILNLIIMYIGFQLSRKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF594 conjugate, 0.1mg/mL
BNC942336-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sspn Mouse Gene Knockout Kit (CRISPR)
KN516767 1 Kit

Sspn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wnt5b Antibody
KC-6192-01 50 μL

Wnt5b Antibody

Sign In for Pricing
View Details
Wnt5b Antibody
KC-6192-02 100 µL

Wnt5b Antibody

Sign In for Pricing
View Details
Wnt5b Antibody
KC-6192-03 1 mL

Wnt5b Antibody

Sign In for Pricing
View Details
3,4-Dichlorobenzyl bromide
TRC-D436523-500MG 500 mg

3,4-Dichlorobenzyl bromide

Sign In for Pricing
View Details