Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sugarcane streak virus Movement protein (V2)

This Recombinant Sugarcane streak virus Movement protein (V2) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q89448

Expression Region

1-109

Origin

Sugarcane streak virus (isolate South Africa) (SSV) (Sugarcane streak virus (isolate Natal) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSFGRAPPLWPQSALPRVPGAAPSSSGLPWSRVGEIAIFTFVAVLALYLLWSWVGRDLL LVLKARRGGTTEELTFGPRERHSLPAVAVARVENPPCPSGSVEARPFTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Juxtanodin ELISA Kit
MBS084058-01 48 Well

Canine Juxtanodin ELISA Kit

Sign In for Pricing
View Details
Canine Juxtanodin ELISA Kit
MBS084058-02 96 Well

Canine Juxtanodin ELISA Kit

Sign In for Pricing
View Details
Canine Juxtanodin ELISA Kit
MBS084058-03 5x 96 Well

Canine Juxtanodin ELISA Kit

Sign In for Pricing
View Details
Canine Juxtanodin ELISA Kit
MBS084058-04 10x 96 Well

Canine Juxtanodin ELISA Kit

Sign In for Pricing
View Details
BLZF1 antibody
70R-32132 0.1 mg

BLZF1 antibody

Sign In for Pricing
View Details
Recombinant NEL Like Protein 2 (NELL2)
SIPL911Hu01-01 10 µg

Recombinant NEL Like Protein 2 (NELL2)

Sign In for Pricing
View Details