Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein reprimo (RPRM)

This Recombinant Human Protein reprimo (RPRM) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q9NS64

Expression Region

1-109

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), 0.2mg/mL
BNUB2290-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), 0.2mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), 1mg/mL
BNUM0700-50 1x 50 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), 1mg/mL

Sign In for Pricing
View Details
STAT4 (NM_003151) Human Over-expression Lysate
LC401095 20 µg

STAT4 (NM_003151) Human Over-expression Lysate

Sign In for Pricing
View Details
8-Bromo-2’-deoxyguanosine
TRC-B682835-25MG 25 mg

8-Bromo-2’-deoxyguanosine

Sign In for Pricing
View Details
ABL1 Antibody
8C10256-AAT 50 µg

ABL1 Antibody

Sign In for Pricing
View Details
ST6GALNAC6 (NM_001287002) Human Tagged ORF Clone
RG237297 10 µg

ST6GALNAC6 (NM_001287002) Human Tagged ORF Clone

Sign In for Pricing
View Details