Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein reprimo (RPRM)

This Recombinant Human Protein reprimo (RPRM) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q9NS64

Expression Region

1-109

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Azide
TRC-S612530-5G 5 g

Sodium Azide

Sign In for Pricing
View Details
SLC36A1 (1-30) Rabbit Polyclonal Antibody
AP39032PU-N 200 µL

SLC36A1 (1-30) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)
TRC-D638870-500MG 500 mg

1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)

Sign In for Pricing
View Details
2-(tert-Butyl)thiophene
TRC-B703608-500MG 500 mg

2-(tert-Butyl)thiophene

Sign In for Pricing
View Details
Human CATSPER1 activation kit by CRISPRa
GA114625 1 Kit

Human CATSPER1 activation kit by CRISPRa

Sign In for Pricing
View Details
NEDD4 2 (NEDD4L) Human Gene Knockout Kit (CRISPR)
KN217897BN 1 Kit

NEDD4 2 (NEDD4L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details