Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein reprimo (RPRM)

This Recombinant Human Protein reprimo (RPRM) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q9NS64

Expression Region

1-109

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCP Mouse Monoclonal Antibody [Clone ID: Hs-14]
AM03029PU-N 100 µg

VCP Mouse Monoclonal Antibody [Clone ID: Hs-14]

Sign In for Pricing
View Details
SALL4 Recombinant Mouse Monoclonal Antibody [A7A7-R]
HA601265 100 µL

SALL4 Recombinant Mouse Monoclonal Antibody [A7A7-R]

Sign In for Pricing
View Details
Ptpn3 Mouse Gene Knockout Kit (CRISPR)
KN514217 1 Kit

Ptpn3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adapter pack for 7ml tubes in Z207-A rotors, 2/pk.
Z326-15-A7 1 Each

Adapter pack for 7ml tubes in Z207-A rotors, 2/pk.

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon
CD564939 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details
(R)-Phenylephrine Hydrochloride
TRC-P320640-50MG 50 mg

(R)-Phenylephrine Hydrochloride

Sign In for Pricing
View Details