Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein reprimo (Rprm)

This Recombinant Mouse Protein reprimo (Rprm) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q9JJ72

Expression Region

1-109

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung: left upper lobe
CB618735 1 Block

Frozen Tissue Blocks, Lung: left upper lobe

Sign In for Pricing
View Details
C12orf76 Human qPCR Primer Pair (NM_207435)
HP219739 200 Reactions

C12orf76 Human qPCR Primer Pair (NM_207435)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS702383 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
2-Benzoyloxy-4,6-dihydroxybenzaldehyde
TRC-B208335-100MG 100 mg

2-Benzoyloxy-4,6-dihydroxybenzaldehyde

Sign In for Pricing
View Details
eRF1 (ETF1) (NM_004730) Human Recombinant Protein
TP320387 20 µg

eRF1 (ETF1) (NM_004730) Human Recombinant Protein

Sign In for Pricing
View Details
PD-L1 Antibody
KC-8667-01 50 μL

PD-L1 Antibody

Sign In for Pricing
View Details