Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein reprimo (Rprm)

This Recombinant Mouse Protein reprimo (Rprm) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q9JJ72

Expression Region

1-109

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI3B12]
CF805520 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI3B12]

Sign In for Pricing
View Details
Mouse Apbb2 activation kit by CRISPRa
GA200223 1 Kit

Mouse Apbb2 activation kit by CRISPRa

Sign In for Pricing
View Details
GVINP1 Antibody
KC-41778-01 50 μL

GVINP1 Antibody

Sign In for Pricing
View Details
GVINP1 Antibody
KC-41778-02 100 µL

GVINP1 Antibody

Sign In for Pricing
View Details
GVINP1 Antibody
KC-41778-03 1 mL

GVINP1 Antibody

Sign In for Pricing
View Details
ARMS2 (NM_001099667) Human Recombinant Protein
TP701006 20 µg

ARMS2 (NM_001099667) Human Recombinant Protein

Sign In for Pricing
View Details