Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein reprimo (Rprm)

This Recombinant Mouse Protein reprimo (Rprm) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Protein reprimo

UniProt

Q9JJ72

Expression Region

1-109

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDHR5 Polyclonal Antibody
E-AB-90700-01 60 µL

CDHR5 Polyclonal Antibody

Sign In for Pricing
View Details
CDHR5 Polyclonal Antibody
E-AB-90700-02 120 µL

CDHR5 Polyclonal Antibody

Sign In for Pricing
View Details
CDHR5 Polyclonal Antibody
E-AB-90700-03 200 µL

CDHR5 Polyclonal Antibody

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF647 conjugate, 0.1mg/mL
BNC470373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GART Antibody
RC-16401-01 50 μL

Recombinant GART Antibody

Sign In for Pricing
View Details
Recombinant GART Antibody
RC-16401-02 100 µL

Recombinant GART Antibody

Sign In for Pricing
View Details