Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bdellovibrio phage phiMH2K Uncharacterized protein N (ORFN)

This Recombinant Bdellovibrio phage phiMH2K Uncharacterized protein N (ORFN) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Uncharacterized protein N

UniProt

Q9G049

Expression Region

1-109

Origin

Bdellovibrio phage phiMH2K (Bacteriophage phiMH2K)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METKPNALTGTSLSSTSGQTTQKSITLQNSENKYIPQNSSETFGLMAILNLALLLWTLLA TLRVTLQKNWPTETTKTTTITQFTTLQKNTPSAKNGLKNTTNKHSHEDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF405S conjugate, 0.1mg/mL
BNC041999-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCNA (PCNA/694), CF594 conjugate, 0.1mg/mL
BNC940694-100 1x 100 µL

PCNA (PCNA/694), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), CF640R conjugate, 0.1mg/mL
BNC401705-500 1x 500 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), CF568 conjugate, 0.1mg/mL
BNC680765-500 1x 500 µL

Chromogranin A (CHGA/765), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details