Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Aquaporin-2 (AQP2)

This Recombinant Dog Aquaporin-2 (AQP2) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Aquaporin-2, AQP-2, ADH water channel, Aquaporin-CD, AQP-CD, Collecting duct water channel protein, WCH-CD, Water channel protein for renal collecting duct

UniProt

P79144

Expression Region

1-109

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHVSGA HINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPPHVRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-100 1x 100 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details