Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1)

This Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CRYM-AS1, CRYM antisense RNA 1, CRYM antisense gene protein 1

UniProt

A6NIL9

Expression Region

1-109

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFAA QPVDEVPFYITASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy5 tyramide
11066-AAT 1 mg

Cy5 tyramide

Sign In for Pricing
View Details
RAB27A (NM_183236) Human Recombinant Protein
TP323511M 100 µg

RAB27A (NM_183236) Human Recombinant Protein

Sign In for Pricing
View Details
GCOM1 (MYZAP) (NM_152451) Human Recombinant Protein
TP760403 50 µg

GCOM1 (MYZAP) (NM_152451) Human Recombinant Protein

Sign In for Pricing
View Details
Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: L1C1]
AM33125PU-S 100 µg

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: L1C1]

Sign In for Pricing
View Details
Double Arm LED Operating Lamp BOPL-408
BOPL-408 Each

Double Arm LED Operating Lamp BOPL-408

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]
TA506104AM 100 µL

CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]

Sign In for Pricing
View Details