Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1)

This Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CRYM-AS1, CRYM antisense RNA 1, CRYM antisense gene protein 1

UniProt

A6NIL9

Expression Region

1-109

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFAA QPVDEVPFYITASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Uterus
CS804338 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
DPY30 Rabbit Polyclonal Antibody
R1312-4 100 µL

DPY30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Conjugated Vigna radiata Lectin (Mung Bean) -VRA-
F-6501-1 1 mg

FITC Conjugated Vigna radiata Lectin (Mung Bean) -VRA-

Sign In for Pricing
View Details
STEAP4 Rabbit Polyclonal Antibody
AP23641PU-N 50 µL

STEAP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB512339 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS627250 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details