Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1)
This Recombinant Human Putative uncharacterized protein CRYM-AS1 (CRYM-AS1) spans the amino acid sequence from region 1-109.
Product Specifications
Product Name Alternative
Putative uncharacterized protein CRYM-AS1, CRYM antisense RNA 1, CRYM antisense gene protein 1
UniProt
A6NIL9
Expression Region
1-109
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFAA QPVDEVPFYITASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470920-100 1x 100 µL
Myosin, Smooth Muscle Heavy Chain (ID8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471602-500 1x 500 µL
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN219851 1 Kit
VEGF Receptor 2 (KDR) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 