Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dasypus novemcinctus Aquaporin-2 (AQP2)

This Recombinant Dasypus novemcinctus Aquaporin-2 (AQP2) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Aquaporin-2, AQP-2, ADH water channel, Aquaporin-CD, AQP-CD, Collecting duct water channel protein, WCH-CD, Water channel protein for renal collecting duct

UniProt

P79164

Expression Region

1-109

Origin

Dasypus novemcinctus (Nine-banded armadillo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVAFSRAVLAEFLATLIFVFFGLGSALSWPQALPSVLQIALAFGLAIGTLVQALGHVSGA HINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPPDVRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details