Recombinant Elephas maximus Aquaporin-2 (AQP2)
This Recombinant Elephas maximus Aquaporin-2 (AQP2) spans the amino acid sequence from region 1-109.
Product Specifications
Product Name Alternative
Aquaporin-2, AQP-2, ADH water channel, Aquaporin-CD, AQP-CD, Collecting duct water channel protein, WCH-CD, Water channel protein for renal collecting duct
UniProt
P79168
Expression Region
1-109
Origin
Elephas maximus (Indian elephant)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SIAFSRAVFSEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLAIGTLVQTLGHISGA HINPAVTVACLVGCHVSFLRATFYLAAQLLGAVAGAALLHELTPPDIRG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-500 1x 500 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881037-100 1x 100 µL
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
