Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0092 membrane protein YajC (yajC)

This Recombinant UPF0092 membrane protein YajC (yajC) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

UPF0092 membrane protein YajC

UniProt

P0ADZ9

Expression Region

1-110

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD EVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details