Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 233 (Tmem233)

This Recombinant Mouse Transmembrane protein 233 (Tmem233) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 233

UniProt

D3Z1U7

Expression Region

1-110

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQYASRSDSKGALDSSSPEAYTEDDKTEEDIPAPSNYLWLTIISCFCPAYPVNIVALVF SIMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLVIIGVSCAVHFSRNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
43793121 3x 1.0µg DNA

SIP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TOMM20 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61211R-PerCP-Cy5.5 100 µL

TOMM20 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
VOC Propionitrile (ethyl cyanide) Neat - 10MG
REVOC390N 10 mg

VOC Propionitrile (ethyl cyanide) Neat - 10MG

Sign In for Pricing
View Details
Lentiviral mouse Hspb8 shRNA (UAS) - Lentiviral mouseHspb8 shRNA (UAS, GFP) (25)
GTR15165320 1 Vial

Lentiviral mouse Hspb8 shRNA (UAS) - Lentiviral mouseHspb8 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Guinea Pig Choline phosphoglyceride ELISA kit
GTR10428609 96 Well

Guinea Pig Choline phosphoglyceride ELISA kit

Sign In for Pricing
View Details
DAD1 Antibody
3313-002mg 0.02 mg

DAD1 Antibody

Sign In for Pricing
View Details