Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 233 (Tmem233)

This Recombinant Mouse Transmembrane protein 233 (Tmem233) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 233

UniProt

D3Z1U7

Expression Region

1-110

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQYASRSDSKGALDSSSPEAYTEDDKTEEDIPAPSNYLWLTIISCFCPAYPVNIVALVF SIMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLVIIGVSCAVHFSRNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
23336111 3x 1.0 µg

HIST1H2BB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
DCLK1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0565604 1.0 µg DNA

DCLK1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TNFRSF17-set siRNA/shRNA/RNAi Lentivector (Human)
47207091 4x 500 ng

TNFRSF17-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
KPNA6 Rabbit pAb
E45R27329N-100 100 µL

KPNA6 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Pan2 shRNA (UAS) - Lentiviral mouse Pan2 shRNA (UAS) plasmid
GTR15250783 1 Vial

Lentiviral mouse Pan2 shRNA (UAS) - Lentiviral mouse Pan2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Fa2h 3'UTR Lenti-reporter-Luc Vector
19631086 1.0 µg

Fa2h 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details