Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 93 (tmem93)

This Recombinant Danio rerio Transmembrane protein 93 (tmem93) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 93

UniProt

Q6P0F0

Expression Region

1-110

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASVAAKREGPQFISEVSVRGNGAVLDYCRTSVSALSGATAGILGLTGLYGFVFYFLASF LLSLLLILKAGRRWNKCFKSRRLLFTGGLVGGLFTYVLFWTFLYGMVHVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405S conjugate, 0.1mg/mL
BNC041099-100 1x 100 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF405S conjugate, 0.1mg/mL
BNC041492-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/6/18 (LP34), CF594 conjugate, 0.1mg/mL
BNC942036-500 1x 500 µL

Cytokeratin 5/6/18 (LP34), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details