Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 93 (TMEM93)

This Recombinant Human Transmembrane protein 93 (TMEM93) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 93

UniProt

Q9BV81

Expression Region

1-110

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPLP0 (NM_053275) Human Over-expression Lysate
LY403287 100 µg

RPLP0 (NM_053275) Human Over-expression Lysate

Sign In for Pricing
View Details
Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]
TA808903AM 100 µL

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]

Sign In for Pricing
View Details
Decoquinate
TRC-D226880-50MG 50 mg

Decoquinate

Sign In for Pricing
View Details
Nesprin3 (SYNE3) Rabbit Polyclonal Antibody
TA382239 100 µL

Nesprin3 (SYNE3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lipoprotein lipase (LPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B4]
TA503784BM 100 µL

Lipoprotein lipase (LPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B4]

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP555253 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details