Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 93 (TMEM93)

This Recombinant Human Transmembrane protein 93 (TMEM93) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 93

UniProt

Q9BV81

Expression Region

1-110

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP3 Antibody
KC-3360-01 50 μL

SP3 Antibody

Sign In for Pricing
View Details
SP3 Antibody
KC-3360-02 100 µL

SP3 Antibody

Sign In for Pricing
View Details
SP3 Antibody
KC-3360-03 1 mL

SP3 Antibody

Sign In for Pricing
View Details
RPL10 Rabbit Polyclonal Antibody
AP01170PU-N 100 µg

RPL10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nandrolone 17-Beta-Undecanoate (1.0mg/ml in Acetonitrile)
TRC-KIT6500-5X1ML 5x 1 mL

Nandrolone 17-Beta-Undecanoate (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
2-Nitrobenzaldehyde-d4
TRC-N492127-5MG 5 mg

2-Nitrobenzaldehyde-d4

Sign In for Pricing
View Details