Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 93 (Tmem93)

This Recombinant Mouse Transmembrane protein 93 (Tmem93) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 93

UniProt

Q9CQW0

Expression Region

1-110

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D8]
TA502287BM 100 µL

GBP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D8]

Sign In for Pricing
View Details
Human IDO1 Recombinant Rabbit monoclonal Antibody
HA723155 100 µL

Human IDO1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Argonaute 2 (AGO2) Human Knockdown Lysate
LY300029 100 µg

Argonaute 2 (AGO2) Human Knockdown Lysate

Sign In for Pricing
View Details
CD117 (Cocktail), Biotin conjugate, 0.1mg/mL
BNCB1018-100 1x 100 µL

CD117 (Cocktail), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cephalomannine
TRC-C258500-10MG 10 mg

Cephalomannine

Sign In for Pricing
View Details
MTRNR2L8 Human Gene Knockout Kit (CRISPR)
KN430908 1 Kit

MTRNR2L8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details