Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 93 (Tmem93)

This Recombinant Mouse Transmembrane protein 93 (Tmem93) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 93

UniProt

Q9CQW0

Expression Region

1-110

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SRRM5 activation kit by CRISPRa
GA119190 1 Kit

Human SRRM5 activation kit by CRISPRa

Sign In for Pricing
View Details
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Recombinant Protein
TP310717L 1 mg

Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Recombinant Protein

Sign In for Pricing
View Details
CMPK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA505389BM 100 µL

CMPK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
Recombinant NDUFS8 Antibody
RC-4563-01 50 μL

Recombinant NDUFS8 Antibody

Sign In for Pricing
View Details
Recombinant NDUFS8 Antibody
RC-4563-02 100 µL

Recombinant NDUFS8 Antibody

Sign In for Pricing
View Details
Recombinant NDUFS8 Antibody
RC-4563-03 1 mL

Recombinant NDUFS8 Antibody

Sign In for Pricing
View Details