Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 93 (Tmem93)

This Recombinant Mouse Transmembrane protein 93 (Tmem93) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Transmembrane protein 93

UniProt

Q9CQW0

Expression Region

1-110

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]
TA503401AM 100 µL

PGAM2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
Rpl7l1 Mouse Gene Knockout Kit (CRISPR)
KN515057 1 Kit

Rpl7l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAGic Clamp™ Tube Rack, 4 x 15ml tubes, horizontal
H1000-MR-T150H 1 Each

MAGic Clamp™ Tube Rack, 4 x 15ml tubes, horizontal

Sign In for Pricing
View Details
FITC Conjugated Laburnum anagyroides Lectin (Gold Chain) -LAL-
F-8101-1 1 mg

FITC Conjugated Laburnum anagyroides Lectin (Gold Chain) -LAL-

Sign In for Pricing
View Details
Lrrc74b Mouse Gene Knockout Kit (CRISPR)
KN500369 1 Kit

Lrrc74b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLGLB1 Rabbit Polyclonal Antibody
TA370274 100 µL

PLGLB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details