Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein HUR1 (HUR1)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein HUR1 (HUR1) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Putative uncharacterized protein HUR1

UniProt

P45820

Expression Region

1-110

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFILVSVVNICTYIHLHMFPLISTFTSIGLGVLMKDKGKEGKTIKAQNVTYQTFEKYVES SSFFFLVHNFLNSSTMKTLLLMSNNNSISEIPSFSVLKILWKNGIYIAHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF568 conjugate, 0.1mg/mL
BNC682003-500 1x 500 µL

CD8b, Mouse (H35-17.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF405S conjugate, 0.1mg/mL
BNC041074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF594 conjugate, 0.1mg/mL
BNC941154-500 1x 500 µL

Mucin 3 (MUC3/1154), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details