Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR069W (YGR069W)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR069W (YGR069W) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YGR069W

UniProt

P53245

Expression Region

1-111

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLLHPILAESCTRYFLLLPSYTHPNHLFHFPSISFFFFFFFFFFSFRRNCLFRIVKDEV KYSGVYYYIHTKQDKETFLDLTFYFNCFCIPYNKKDLLFNVGVIRPLLDLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-100 1x 100 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details