Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-Ia immunity protein

This Recombinant Colicin-Ia immunity protein spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Colicin-Ia immunity protein

UniProt

P08701

Expression Region

1-111

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRKYYFNNMWWGWVTGGYMLYMSWDYEFKYRLLFWCISLCGMVLYPVAKWYIEDTALKF TRPDFWNSGFFADTPGKMGLLAVYTGTVFILSLPLSMIYILSVIIKRLSVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gossypol-d2
TRC-G766542-2.5MG 2.5 mg

Gossypol-d2

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), 0.2mg/mL
BNUB2745-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Colon: left
CR562756 5 µg

Tissue Total RNA, Colon: left

Sign In for Pricing
View Details
ST2 (IL1RL1) Mouse Monoclonal Antibody [Clone ID: OTI1H4C4]
CF810031 100 µg

ST2 (IL1RL1) Mouse Monoclonal Antibody [Clone ID: OTI1H4C4]

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF640R Conjugate, 0.1 mg/mL
BNC401331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF640R Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (rC81/3442), CF740 conjugate, 0.1mg/mL
BNC743442-100 1x 100 µL

CD81 / TAPA-1 (rC81/3442), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details