Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-Ia immunity protein

This Recombinant Colicin-Ia immunity protein spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Colicin-Ia immunity protein

UniProt

P08701

Expression Region

1-111

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRKYYFNNMWWGWVTGGYMLYMSWDYEFKYRLLFWCISLCGMVLYPVAKWYIEDTALKF TRPDFWNSGFFADTPGKMGLLAVYTGTVFILSLPLSMIYILSVIIKRLSVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Preactivated APC-Cy7 Tandem
2587-AAT 1 mg

ReadiUse™ Preactivated APC-Cy7 Tandem

Sign In for Pricing
View Details
(E)-3-(2-Fluorophenyl)-N-((S)-1-(3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]acrylamide
TRC-F595708-2MG 2 mg

(E)-3-(2-Fluorophenyl)-N-((S)-1-(3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]acrylamide

Sign In for Pricing
View Details
Tropine-3-thiol Hydrochloride
TRC-T892675-5G 5 g

Tropine-3-thiol Hydrochloride

Sign In for Pricing
View Details
Txn2 Mouse Gene Knockout Kit (CRISPR)
KN318507LP 1 Kit

Txn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phenmedipham-ethyl
TRC-P314605-500MG 500 mg

Phenmedipham-ethyl

Sign In for Pricing
View Details
PIK3C2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B1]
TA506052BM 100 µL

PIK3C2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B1]

Sign In for Pricing
View Details