Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-Ia immunity protein

This Recombinant Colicin-Ia immunity protein spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Colicin-Ia immunity protein

UniProt

P08701

Expression Region

1-111

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRKYYFNNMWWGWVTGGYMLYMSWDYEFKYRLLFWCISLCGMVLYPVAKWYIEDTALKF TRPDFWNSGFFADTPGKMGLLAVYTGTVFILSLPLSMIYILSVIIKRLSVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF640R conjugate, 0.1mg/mL
BNC402155-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ANXA5 Polyclonal Antibody
D-AB-10212L-01 25 µL

ANXA5 Polyclonal Antibody

Sign In for Pricing
View Details
ANXA5 Polyclonal Antibody
D-AB-10212L-02 100 µL

ANXA5 Polyclonal Antibody

Sign In for Pricing
View Details
Moesin (MSN/492), CF740 conjugate, 0.1mg/mL
BNC740492-100 1x 100 µL

Moesin (MSN/492), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]
TA503419BM 100 µL

CCM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
Edivoxetine Hydrochloride
TRC-E335300-250MG 250 mg

Edivoxetine Hydrochloride

Sign In for Pricing
View Details