Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ydgC (ydgC)

This Recombinant Inner membrane protein ydgC (ydgC) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Inner membrane protein ydgC

UniProt

P0ACX1

Expression Region

1-111

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCF4 Rabbit Polyclonal Antibody
AP06549PU-N 100 µg

NCF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmsb15b1 Mouse Gene Knockout Kit (CRISPR)
KN517949 1 Kit

Tmsb15b1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF647 conjugate, 0.1mg/mL
BNC472470-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR1248 Human qPCR Primer Pair (MI0006383)
HP300068 200 Reactions

MIR1248 Human qPCR Primer Pair (MI0006383)

Sign In for Pricing
View Details
AHA1 (AHSA1) Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF808924 100 µg

AHA1 (AHSA1) Mouse Monoclonal Antibody [Clone ID: OTI1D2]

Sign In for Pricing
View Details
4930449I24Rik Mouse Gene Knockout Kit (CRISPR)
KN500368 1 Kit

4930449I24Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details